DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:88/236 - (37%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHC-GDSIGVIRARLGEYGRIGSELAEDHIVA 102
            :|:...|:|..|...|.....|::|...::||..|| ||:..|| ...|...|..::..  |.| 
  Fly    43 APEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVI-VYFGATWRTNAQFT--HTV- 103

  Fly   103 AFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN---------GT 158
               .|.||...:.|:    :.|:|.    .|:....::....:.::.|..:.:|         |.
  Fly   104 ---GNGNFIKHSNAD----IALIRI----PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGG 157

  Fly   159 TWKNSDKSPMLRSKTV-IRMPQAC----GKLDHGQFCAGHKDLDS-CDEPSGAALTREIDYIGPN 217
            |:..|.....|:...: |...:.|    |.:.....|....|..| |...||..|      :..:
  Fly   158 TYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTRTVDGKSICGGDSGGPL------VTHD 216

  Fly   218 RTVLFGIANSVEVK-CSNSR-------TY-TDVVQLHQWIS 249
            .:.|.|::|.|... |.:..       || .|.::.|..||
  Fly   217 GSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTGIS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 52/233 (22%)
Tryp_SPc 42..248 CDD:214473 50/230 (22%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 50/227 (22%)
Tryp_SPc 37..253 CDD:238113 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.