DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and psh

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:234 Identity:55/234 - (23%)
Similarity:90/234 - (38%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAE--DH----IVAAFFSNANFNPE---TQ 115
            |:||..||:||..||.::    .|....:.|:|:...|  ||    ||   ..:...:|:   .:
  Fly   174 GSLIASRFVLTAAHCVNT----DANTPAFVRLGAVNIENPDHSYQDIV---IRSVKIHPQYVGNK 231

  Fly   116 ANNMGLMKLLRTVVYKEHIIPVCILMD-----SRMQTFADELDYFNGTTWKNSDKSPMLRSKTVI 175
            .|::.:::|.|.||..::|.|.|:..|     |..:.|.......|.||        ..|||.::
  Fly   232 YNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTT--------RARSKILL 288

  Fly   176 R-----------------MPQACGKLDHG----QFCAGHKDL--DSCDEPSGAALTREIDYIGPN 217
            |                 .|.:...|..|    ..||..:.|  |:|...||..|..|::.....
  Fly   289 RAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGM 353

  Fly   218 RTVLFGIANSVEVKCSNSRTYTDVVQLHQWISMVIYSSN 256
            .|::..|::...........||.|.....:|..:::..|
  Fly   354 YTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/227 (24%)
Tryp_SPc 42..248 CDD:214473 53/224 (24%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 53/224 (24%)
Tryp_SPc 144..387 CDD:238113 54/227 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.