DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG31220

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:280 Identity:74/280 - (26%)
Similarity:111/280 - (39%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSAQFLGNICGERRDGLSPDI-VGPWTAILHHFGRIV-----------GVGTLIHERFILTDVHC 74
            |..|....:.|    |..|:: ..||.|:|.:..|..           | |:||:.|::||..||
  Fly    96 GKPQTTNRVIG----GTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCG-GSLINTRYVLTAAHC 155

  Fly    75 -GDSI-GVIRARLGEY------------GRIGSELAEDHI---VAAFFSNANFNPE--TQANNMG 120
             .|:: .:.|.||||:            .||  ..|..|:   |.:..|:.:::|.  |..|::.
  Fly   156 VTDTVLQIQRVRLGEHTTSHNPDCISRGARI--VCAPTHLDIDVESITSHNDYDPANYTFRNDIA 218

  Fly   121 LMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN------GTTWKNSDKSPMLRSKTV-IRMP 178
            |::|...|.|.....|:|:|      .:...|..|.      |.|......|.:|:...| :|.|
  Fly   219 LVRLKEPVRYTMAYYPICVL------DYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKP 277

  Fly   179 QACG-KLDHGQF------CAGHKD-LDSCDEPSGAALT----REIDYIGPNRTVLFGIANSVEVK 231
            :.|. |..|..|      |||..| ..:||..||:.|.    |..:.|    |.|.|| .|....
  Fly   278 EECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETI----TFLAGI-TSYGGP 337

  Fly   232 CSN---SRTYTDVVQLHQWI 248
            |..   ...:|...:.::||
  Fly   338 CGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 69/260 (27%)
Tryp_SPc 42..248 CDD:214473 67/258 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 70/271 (26%)
Tryp_SPc 104..360 CDD:238113 72/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.