DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG8952

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:218 Identity:45/218 - (20%)
Similarity:88/218 - (40%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHH--FGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGE---YGRIGSELAEDHIVAAF 104
            ||..||..  :..::..|::|.:.::||..||.:.:..|....|.   :......:..::|:.  
  Fly    50 PWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIII-- 112

  Fly   105 FSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDY---------FNGTTW 160
              :.::|.:.. |::.|::|...:.:..:|..:.:     :..:.|.:||         |..|..
  Fly   113 --HPDYNDKLN-NDVSLIQLPEPLTFSANIQAIQL-----VGQYGDSIDYVGSVATIAGFGYTED 169

  Fly   161 KNSDKSPMLRSKTVIRMPQACGKLDHGQF-------CA---GHKDLDSCDEPSGAALTREIDYIG 215
            :..|.|..|....|..:..|.....:|::       ||   ...|:.:|...||..|   |.|  
  Fly   170 EYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILY-- 229

  Fly   216 PNRTV----LFGIANSV-EVKCS 233
             |:|:    ..||.:.| |.:|:
  Fly   230 -NKTIQQWQQIGINSFVAEDQCT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 45/218 (21%)
Tryp_SPc 42..248 CDD:214473 45/218 (21%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 45/218 (21%)
Tryp_SPc 38..271 CDD:238113 45/218 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.