DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG30187

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:273 Identity:79/273 - (28%)
Similarity:116/273 - (42%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLSGTGSAQFLGNICGERRDGLSPDIVG---------PWTAILHHFGRIVGVGTLIHERFILTDV 72
            ||...|::.||..|||   ..::..|.|         .|.|.:|:....:..|||||:||:||..
  Fly    14 FLKDVGASIFLDQICG---INIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAA 75

  Fly    73 HCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPV 137
            ||.....|....||.|.:......:|.|.|...|:.:.....: |::||:||...|::...|.|:
  Fly    76 HCIVDQDVQSVSLGAYNKSDPADRKDVITAVVHSSFDVRASYE-NDIGLLKLSSDVIFNALIRPI 139

  Fly   138 CILMDSRMQTFADELDYFNGTTW---KNSDKSPMLRSKTVIRMPQACGKLDH------------- 186
            ||:::..|......:..|....|   :.:..|.:|  :|:|        |:|             
  Fly   140 CIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDIL--QTII--------LNHLDREECYMELSVY 194

  Fly   187 ---GQFCAGHKDLDSCDEPSGAALTRE--IDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQ 246
               .|.|||....|:|...||..||.:  |..|| ||.|.|||.:..:..|.....|||::....
  Fly   195 PSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIG-NREVQFGIISVGKTSCDGQGVYTDLMSFAD 258

  Fly   247 WISMVIYSSNTND 259
            ||.|.|...:..|
  Fly   259 WIKMTIERLSIED 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 68/238 (29%)
Tryp_SPc 42..248 CDD:214473 66/235 (28%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 66/236 (28%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.