DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG30091

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:273 Identity:64/273 - (23%)
Similarity:118/273 - (43%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGTGSAQFLGNICGERRDGLSPDIVG---------PWTAILHHFGRIVGVGTLIHERFILTDVH- 73
            :|.|||:.|...||.... |.|.|||         ||.|::......:..|::|..:|:||..| 
  Fly    15 AGRGSARLLDEDCGVPMQ-LIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHC 78

  Fly    74 -CGDSIGVIRARLGEYGRIGSELAEDHIVAA--------------FFSNANFNPETQANNMGLMK 123
             |.|...:::     |.::...|...|::|.              .:.:.:|..:...|::.|::
  Fly    79 MCTDEECIVK-----YTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLR 138

  Fly   124 LLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDKSPMLRSKTVIRMPQACGKL---- 184
            |.:::|||..|.|:|||::.:::...|.:..|....|..:....|..:..::::.:...|:    
  Fly   139 LQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAA 203

  Fly   185 -----DHGQFCAGHK-DLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQ 243
                 |:..||||.. ..|:|...||..|...:.:.|..|....||.::....|.....||||:.
  Fly   204 FWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMG 268

  Fly   244 LHQWISMVIYSSN 256
            ...:|..::..::
  Fly   269 HIDFIERIVLDAD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/243 (23%)
Tryp_SPc 42..248 CDD:214473 54/240 (23%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 54/241 (22%)
Tryp_SPc 37..276 CDD:238113 55/243 (23%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.