DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG30090

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:298 Identity:83/298 - (27%)
Similarity:141/298 - (47%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVLTSLLI-FLSGTGSAQFLGNICGERRDGLSPDIVG---------PWTAILHHFGRIVGVGTL 62
            :|.:|:|.| .|...|:.::|...||...:.::..|:|         ||.|.:|...:::..|||
  Fly     5 IAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTL 69

  Fly    63 IHERFILTDVHCGDSIGVIRARLGEYGRIGSE---------LAEDHIVAAFFSNANFNPETQANN 118
            |.:||:||..||.:....::.|||||....:|         .||:|.|...|.:..|:.....|:
  Fly    70 ITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLND 134

  Fly   119 MGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDKSPMLRSKTVIRMP----- 178
            :.|::|.:.|.:|.||.|:||::.:..:...|.:::|..|.|   .::...|::.|:::.     
  Fly   135 IALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGW---GETRTHRTRGVLQITQLQRY 196

  Fly   179 ------QACGKL-DHGQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSR 236
                  ||.|:| ...|.|||....|:|:..||..|.:.:.::...|.|.||:.:....:||...
  Fly   197 NSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG 261

  Fly   237 TYTDVVQLHQWISMVIYSSNTNDGMDKPHNTTHLPEPV 274
            .||||.....||:.|:            ...||:|.|:
  Fly   262 VYTDVYSYADWIATVV------------QQNTHVPAPI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 69/238 (29%)
Tryp_SPc 42..248 CDD:214473 67/235 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 67/236 (28%)
Tryp_SPc 40..276 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.