DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and F7

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:277 Identity:70/277 - (25%)
Similarity:112/277 - (40%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CG-----ERRDGLSPD--IVG---------PWTAILHHFGRIVGVGTLIHERFILTDVHCGDSIG 79
            ||     |:|:...|.  |||         ||..:|...|..:..||||:..::::..||.|.|.
Human   224 CGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIK 288

  Fly    80 VIR---ARLGEYG---RIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVC 138
            ..|   |.|||:.   ..|.|  :...||.....:.:.|.|..:::.|::|.:.||..:|::|:|
Human   289 NWRNLIAVLGEHDLSEHDGDE--QSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLC 351

  Fly   139 ILMDSRMQTFADELDYF------NGTTW-KNSDKSPMLRSKTVIRMP----QAC----------G 182
            :    ..:||::....|      :|  | :..|:........|:.:|    |.|          .
Human   352 L----PERTFSERTLAFVRFSLVSG--WGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSP 410

  Fly   183 KLDHGQFCAGHKD--LDSCDEPSGAALTREIDYIGPNRT------VLFGIANSVE--VKCSNSRT 237
            .:....||||:.|  .|||...||          ||:.|      .|.||.:..:  ....:...
Human   411 NITEYMFCAGYSDGSKDSCKGDSG----------GPHATHYRGTWYLTGIVSWGQGCATVGHFGV 465

  Fly   238 YTDVVQLHQWISMVIYS 254
            ||.|.|..:|:..::.|
Human   466 YTRVSQYIEWLQKLMRS 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 64/254 (25%)
Tryp_SPc 42..248 CDD:214473 63/251 (25%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.