DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and T22A3.6

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:173 Identity:31/173 - (17%)
Similarity:56/173 - (32%) Gaps:68/173 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LMDSRMQTFA------DELDYFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQFC-AGHKDLD 197
            :.||...:::      ||.:.|    .:|.||:|:                  |.:| .|:....
 Worm   124 ISDSSSSSYSMNRILPDEYENF----CRNPDKNPL------------------GPWCYVGNDTTA 166

  Fly   198 SCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYT-----DVVQLHQWISM-----VI 252
            .|.:|...:.....|::..||               :...||     |::.|.|.|.:     ::
 Worm   167 PCFQPCRPSTETSSDFVCLNR---------------DGFPYTDYDMSDILDLPQLIGIFKDVDLM 216

  Fly   253 YSS--------------NTNDGMDKPHNTTHLPEPVFELKSTS 281
            |.|              :|...::|.|...|....:..|..|:
 Worm   217 YESRFVLPSLPDGVQRLSTKSCINKGHIANHFGPWIAVLDQTA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 23/127 (18%)
Tryp_SPc 42..248 CDD:214473 22/119 (18%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.