DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and try-10

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:122 Identity:28/122 - (22%)
Similarity:41/122 - (33%) Gaps:46/122 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LEIVAVLTSLLIFLSGTGSAQFLGNICGERRDGLSPDIVGPWTAILHHFGRIVGVGTLIHERFIL 69
            |.:.:|:|.   |..||      .|:||                           |.||....::
 Worm    87 LSLASVITR---FPDGT------TNVCG---------------------------GVLIAPSIVI 115

  Fly    70 TDVHC---GDSIGV-IRARLGEY----GRIGSELAEDHIVAAFFSNANFNPETQANN 118
            |..||   ||...| .:..||:.    ...|.:....|.:|  .|...||..::||:
 Worm   116 TSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMA--ISKKFFNDASEAND 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 19/85 (22%)
Tryp_SPc 42..248 CDD:214473 19/85 (22%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.