DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh7A1 and CG11634

DIOPT Version :9

Sequence 1:NP_649099.1 Gene:Aldh7A1 / 40097 FlyBaseID:FBgn0036857 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001286129.1 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:237 Identity:47/237 - (19%)
Similarity:71/237 - (29%) Gaps:83/237 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VGQTLVADKRVNLVSFTGSCQTGRDVGVEVQRRFGKVILELGG-NNAL-IIDESANVKMALDAAL 316
            :..|..||:.:           |.||....|.   .:|.|.|. |:|| .|.||.:...|.:|..
  Fly    50 IEMTSEADRHI-----------GHDVTSSPQL---MIIFEEGDINSALHFIIESVHNPFASNAVA 100

  Fly   317 FGCIGTSGQRCTTTRRIIVHEKLHDQFVKELVGKYKQLISKIGHQLEAQTLVGPVHTQQNVENYK 381
            .               ::|.||:..:.|:.::.|...|...:.........:...|| .|....:
  Fly   101 M---------------VLVEEKIRGEIVERILSKLHPLSKFVAEHPSYLAALEKCHT-SNFNIIR 149

  Fly   382 AAIAEAKSLGGTVAFGGNVIQRDGFYVEPTVITGLPHD------ASVVHRETFAPIVYILKAKNV 440
            |.|:|....                ...|..:....||      ..||...||         :|.
  Fly   150 ACISEVAPP----------------MASPIFVCDCTHDKLGSYPTGVVTFHTF---------RNN 189

  Fly   441 DQAIE--------------WNN------EVEQGLSSAIFTEN 462
            .:||.              ||.      ::...|||:.|..|
  Fly   190 QEAIAISQCESLAFASVSIWNETLTGCYDLVAALSSSYFFLN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh7A1NP_649099.1 ALDH_F7_AASADH 51..526 CDD:143448 47/237 (20%)
CG11634NP_001286129.1 DUF1487 64..279 CDD:254173 42/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.