powered by:
Protein Alignment Aldh7A1 and CG31274
DIOPT Version :9
Sequence 1: | NP_649099.1 |
Gene: | Aldh7A1 / 40097 |
FlyBaseID: | FBgn0036857 |
Length: | 540 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_732186.1 |
Gene: | CG31274 / 318655 |
FlyBaseID: | FBgn0051274 |
Length: | 280 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 18/53 - (33%) |
Gaps: | 12/53 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PRRLVTQTASYSSSSSYLIDQPEYSFLKELGLERDNPGVYSGQWQGRGPSVTS 66
||..:.|.. |:..:|..|...|:.........||:||..||
Fly 202 PREYILQVL------------PQLKYLDGLPTSRNAAYATLSSSQGQGPDSTS 242
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.