DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh7A1 and CG31274

DIOPT Version :9

Sequence 1:NP_649099.1 Gene:Aldh7A1 / 40097 FlyBaseID:FBgn0036857 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:53 Identity:13/53 - (24%)
Similarity:18/53 - (33%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PRRLVTQTASYSSSSSYLIDQPEYSFLKELGLERDNPGVYSGQWQGRGPSVTS 66
            ||..:.|..            |:..:|..|...|:.........||:||..||
  Fly   202 PREYILQVL------------PQLKYLDGLPTSRNAAYATLSSSQGQGPDSTS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh7A1NP_649099.1 ALDH_F7_AASADH 51..526 CDD:143448 6/16 (38%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378
leucine-rich repeat 133..154 CDD:275378
leucine-rich repeat 155..181 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.