DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9666 and AT4G28830

DIOPT Version :9

Sequence 1:NP_001137973.1 Gene:CG9666 / 40096 FlyBaseID:FBgn0036856 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001328315.1 Gene:AT4G28830 / 829004 AraportID:AT4G28830 Length:208 Species:Arabidopsis thaliana


Alignment Length:210 Identity:98/210 - (46%)
Similarity:141/210 - (67%) Gaps:10/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDIEGKLVGDLGCGCGMLSIA 68
            :||::||..|..::.|..||:..|||||.||||:.|....::.:.||..|:|.|.|||||.||.|
plant     1 MKLKQLEGLLGDLEQFSNPKVEFEQYPTGPHIASRMLFTAENSYGDITDKVVADFGCGCGTLSAA 65

  Fly    69 STLLGAQLTVGFELDGDAVDTFRGNVVEMELPNVDCVRADV--LQLIGSKWEKSFDTVLMNPPFG 131
            :.||.|...:||::|.::::|...|..|:|: .:|.|:.|:  |:|.|    ...|||:||||||
plant    66 AALLDAASVIGFDIDPESLETATLNAEELEV-EIDFVQCDITKLELKG----LIVDTVVMNPPFG 125

  Fly   132 TKHNAGMDMRFLEVALRLANRAVYSLHKTSTRSYIQKKAL-EWGARGS-VVAELRYNIDASYKFH 194
            |: ..|.||.||..|:::|::|||||||||||.:|::.|| ::.|:.: |:.||||::...||||
plant   126 TR-KKGADMEFLSAAMKVASKAVYSLHKTSTREHIKRAALRDFNAKSAEVICELRYDLPKLYKFH 189

  Fly   195 KQKSKDIEVDFWRFE 209
            |:|..||.||.||||
plant   190 KRKEVDIAVDLWRFE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9666NP_001137973.1 COG2263 7..209 CDD:225172 94/205 (46%)
AT4G28830NP_001328315.1 COG2263 4..204 CDD:225172 94/205 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3117
eggNOG 1 0.900 - - E1_COG2263
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8570
Inparanoid 1 1.050 181 1.000 Inparanoid score I1454
OMA 1 1.010 - - QHG62357
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005008
OrthoInspector 1 1.000 - - oto4273
orthoMCL 1 0.900 - - OOG6_102624
Panther 1 1.100 - - LDO PTHR23290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.