DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9666 and mettl5

DIOPT Version :9

Sequence 1:NP_001137973.1 Gene:CG9666 / 40096 FlyBaseID:FBgn0036856 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001025663.1 Gene:mettl5 / 595055 XenbaseID:XB-GENE-985451 Length:208 Species:Xenopus tropicalis


Alignment Length:205 Identity:120/205 - (58%)
Similarity:153/205 - (74%) Gaps:0/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDIEGKLVGDLGCGCGMLSIA 68
            :||::||..||.||.||.||:|||||||.|||||||.:.:.:...|||.|:|.|||||||:|||.
 Frog     1 MKLKELEGCLQQVDVFENPKLLLEQYPTRPHIAACMLYTIHNTFNDIEDKVVADLGCGCGVLSIG 65

  Fly    69 STLLGAQLTVGFELDGDAVDTFRGNVVEMELPNVDCVRADVLQLIGSKWEKSFDTVLMNPPFGTK 133
            :.:|||.|.:|.::|.||:|.|:.|..|.||.|:|.::.|:..|......||.|||:||||||||
 Frog    66 AAMLGAGLCLGLDVDEDALDIFKTNTEEFELTNIDMIQFDICSLPPDCLSKSVDTVIMNPPFGTK 130

  Fly   134 HNAGMDMRFLEVALRLANRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHKQKS 198
            ||.||||.||..||::|..:||||||||||.:|:|||.:|..:..::|||||::.|||||||:||
 Frog   131 HNKGMDMTFLRTALQMARNSVYSLHKTSTREHIKKKATDWNVKMEIIAELRYDLPASYKFHKKKS 195

  Fly   199 KDIEVDFWRF 208
            .||||||.||
 Frog   196 VDIEVDFIRF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9666NP_001137973.1 COG2263 7..209 CDD:225172 118/202 (58%)
mettl5NP_001025663.1 COG2263 4..207 CDD:225172 118/202 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5794
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8570
Inparanoid 1 1.050 193 1.000 Inparanoid score I3732
OMA 1 1.010 - - QHG62357
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005008
OrthoInspector 1 1.000 - - oto103913
Panther 1 1.100 - - LDO PTHR23290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3707
SonicParanoid 1 1.000 - - X4657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.