DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9666 and Mettl5

DIOPT Version :9

Sequence 1:NP_001137973.1 Gene:CG9666 / 40096 FlyBaseID:FBgn0036856 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001107653.1 Gene:Mettl5 / 502632 RGDID:1566062 Length:209 Species:Rattus norvegicus


Alignment Length:208 Identity:125/208 - (60%)
Similarity:157/208 - (75%) Gaps:1/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDIEGKLVGDLGCGCGML 65
            |.:|||::||..||.|||||:||:|||||||.|||||||.:.:.:.::|||.|.|.|||||||:|
  Rat     1 MKKLKLKELESRLQEVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIESKAVADLGCGCGVL 65

  Fly    66 SIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELPNVDCVRADVLQLIGSKWEKSFDTVLMNPPF 130
            ||.:.:|||.|.|||::|.||::.|..||.|.||.|||.::.||..| .|:..|.||||:|||||
  Rat    66 SIGAAMLGAGLCVGFDIDEDALEIFNKNVEEFELTNVDMIQCDVYSL-SSRMSKLFDTVIMNPPF 129

  Fly   131 GTKHNAGMDMRFLEVALRLANRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHK 195
            |||:|.|.||.||:.||.:|..|||||||:|||.:|||||.||..:..::|||||::.|.|.|||
  Rat   130 GTKNNKGTDMAFLKTALGMARTAVYSLHKSSTREHIQKKAAEWKVKTEIIAELRYDLPALYNFHK 194

  Fly   196 QKSKDIEVDFWRF 208
            :||.|||||..||
  Rat   195 KKSVDIEVDLIRF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9666NP_001137973.1 COG2263 7..209 CDD:225172 121/202 (60%)
Mettl5NP_001107653.1 COG2263 7..209 CDD:225172 121/202 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342402
Domainoid 1 1.000 118 1.000 Domainoid score I5727
eggNOG 1 0.900 - - E1_COG2263
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8570
Inparanoid 1 1.050 255 1.000 Inparanoid score I3100
OMA 1 1.010 - - QHG62357
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005008
OrthoInspector 1 1.000 - - oto97226
orthoMCL 1 0.900 - - OOG6_102624
Panther 1 1.100 - - LDO PTHR23290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.