DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9666 and METTL5

DIOPT Version :9

Sequence 1:NP_001137973.1 Gene:CG9666 / 40096 FlyBaseID:FBgn0036856 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001280115.1 Gene:METTL5 / 29081 HGNCID:25006 Length:209 Species:Homo sapiens


Alignment Length:208 Identity:123/208 - (59%)
Similarity:161/208 - (77%) Gaps:1/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDIEGKLVGDLGCGCGML 65
            |.:::|::||..||.|||||:||:|||||||.|||||||.:.:.:.::|||.|:|.|||||||:|
Human     1 MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVL 65

  Fly    66 SIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELPNVDCVRADVLQLIGSKWEKSFDTVLMNPPF 130
            ||.:.:|||.|.|||::|.||::.|..|..|.||.|:|.|:.||. |:.::..||||||:|||||
Human    66 SIGTAMLGAGLCVGFDIDEDALEIFNRNAEEFELTNIDMVQCDVC-LLSNRMSKSFDTVIMNPPF 129

  Fly   131 GTKHNAGMDMRFLEVALRLANRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHK 195
            |||:|.|.||.||:.||.:|..|||||||:|||.::||||.||..:..::|||||::.|||||||
Human   130 GTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHK 194

  Fly   196 QKSKDIEVDFWRF 208
            :||.|||||..||
Human   195 KKSVDIEVDLIRF 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9666NP_001137973.1 COG2263 7..209 CDD:225172 121/202 (60%)
METTL5NP_001280115.1 COG2263 7..209 CDD:225172 121/202 (60%)