DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and HMS1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_014675.1 Gene:HMS1 / 854197 SGDID:S000005558 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:38/190 - (20%)
Similarity:69/190 - (36%) Gaps:54/190 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IDIESDEDGDS------DTGLGSSRHTNTANFTQAEK-RAHHNALERRRRDHIKESFTNLREAVP 67
            :::|:.::.||      .:.:....|......|:... |..||.:|::.|.:|.:....||..||
Yeast   230 LNLENIDNADSMSFKLKTSPIRKHFHVKPKRITRVRTGRVSHNIIEKKYRSNINDKIEQLRRTVP 294

  Fly    68 TLK------------------------GEKASRAQILKKTTECIQTMRRKISENQKDIEEIKRQN 108
            ||:                        ..|.::|.||.|:.|.|..:.||..:            
Yeast   295 TLRVAYKKCNDLPITSRDLADLDGLEPATKLNKASILTKSIEYICHLERKCLQ------------ 347

  Fly   109 NIIAKQIQALESSNGDQF------SEFLSDEEVGSEEADDE--DLDQDFSRRNKKMKTFH 160
              ::...|.|.:...|.|      |:.|||.. .||:...:  ...:...|:.::.:..|
Yeast   348 --LSLANQHLSNDTRDSFVHLTEPSQPLSDNS-SSEQVQKQTRSCQRQRQRQPRQQQPLH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 19/75 (25%)
HMS1NP_014675.1 bHLHzip_scHMS1_like 265..363 CDD:381405 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.