DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and RTG3

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_009447.1 Gene:RTG3 / 852171 SGDID:S000000199 Length:486 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:39/153 - (25%)
Similarity:67/153 - (43%) Gaps:40/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SRHTN-TANFTQ--------------------AEKRAHHNALERRRRDHIKESFTNLREAVPTL- 69
            :|||: ::|.|:                    ..||..|||:|||||:.||:....|.:.||.. 
Yeast   252 TRHTSISSNMTENIGPGSVPKILGGLTSDEKLRRKREFHNAVERRRRELIKQKIKELGQLVPPSL 316

  Fly    70 -------KGEKASRAQILKKTTECIQTMRRKISENQKDIEEIK-RQNNIIAKQIQALE--SSNGD 124
                   |..|.::..||.:|.|.:|.:        .:|.||: |:...:..:|:.||  .|:..
Yeast   317 LNYDDLGKQIKPNKGIILDRTVEYLQYL--------AEILEIQARKKKALLAKIKELEEKKSSVA 373

  Fly   125 QFSEFLSDEEVGSEEADDEDLDQ 147
            ..|.|.::....|.:.:.|:.::
Yeast   374 ALSPFTNNHHASSGQNNSENSEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 22/58 (38%)
RTG3NP_009447.1 bHLHzip_USF_MITF 289..349 CDD:381393 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.