DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and MYC4

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_193522.1 Gene:MYC4 / 827511 AraportID:AT4G17880 Length:589 Species:Arabidopsis thaliana


Alignment Length:102 Identity:29/102 - (28%)
Similarity:53/102 - (51%) Gaps:7/102 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQILKKTTECIQTMRRKISENQKDIEE 103
            |:..:|...||:||:.:.:.|.:||..||.:  .|..:|.:|......|..::.|:.:.:.|.||
plant   412 EEPLNHVEAERQRREKLNQRFYSLRAVVPNV--SKMDKASLLGDAISYISELKSKLQKAESDKEE 474

  Fly   104 IKRQNNIIAKQIQALESSNGD-----QFSEFLSDEEV 135
            :::|.:::.|:....:||..|     |.|..|.:.||
plant   475 LQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLIEMEV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 14/50 (28%)
MYC4NP_193522.1 bHLH-MYC_N 63..250 CDD:290915
HLH 415..466 CDD:238036 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.