DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mxi1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_031760881.1 Gene:mxi1 / 493491 XenbaseID:XB-GENE-493086 Length:243 Species:Xenopus tropicalis


Alignment Length:135 Identity:31/135 - (22%)
Similarity:60/135 - (44%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQ--ILKKTT 84
            :|||.||.|             ||.||:.||.|::.....|::.:| |:.:.|....  :|.|..
 Frog    76 SGLGISRST-------------HNELEKNRRAHLRLCLERLKDLIP-LESDAARHTTLGLLNKAK 126

  Fly    85 ECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGDQFSEFLSDEEVGSEEADD------E 143
            ..|:.:.......|..:|.::|:...:.::::.|:   |....|.:..:.:||..:.|      |
 Frog   127 LHIKKLEDTSRRGQHQLEVLEREQRFLKRRLEQLQ---GGTEPERVRSDSIGSHASTDPSDSERE 188

  Fly   144 DLDQD 148
            :::.|
 Frog   189 EIEVD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 14/52 (27%)
mxi1XP_031760881.1 bHLHzip_MXI1 81..160 CDD:381500 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.