DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and MYCN

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_005369.2 Gene:MYCN / 4613 HGNCID:7559 Length:464 Species:Homo sapiens


Alignment Length:95 Identity:37/95 - (38%)
Similarity:62/95 - (65%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTL-KGEKASRAQILKKTTECIQT 89
            |.|::::.:   :|:|.:||.|||:||:.::.||..||:.||.| |.|||::..||||.||.:.:
Human   371 SPRNSDSED---SERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHS 432

  Fly    90 MRRKISENQKDIEEIKRQNNIIAKQIQALE 119
            ::.:  |:|..:|:.|.|    |:|.|.|:
Human   433 LQAE--EHQLLLEKEKLQ----ARQQQLLK 456

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 29/68 (43%)