DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and MNT

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_011522170.1 Gene:MNT / 4335 HGNCID:7188 Length:590 Species:Homo sapiens


Alignment Length:157 Identity:41/157 - (26%)
Similarity:70/157 - (44%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKAS 75
            :::|.|......|:|:              |..||.||:.||.|:||.|..|:..:|.:..:|.|
Human   214 EVKSSEQKKRPGGIGT--------------REVHNKLEKNRRAHLKECFETLKRNIPNVDDKKTS 264

  Fly    76 RAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNG-DQFSEFLSDEEV---- 135
            ...:|:.....||:::||..|.:.::|.:.|:.  ||.|.:..|..:. .|:.:.|..:.|    
Human   265 NLSVLRTALRYIQSLKRKEKEYEHEMERLAREK--IATQQRLAELKHELSQWMDVLEIDRVLRQT 327

  Fly   136 GSEEAD--------------DEDLDQD 148
            |..|.|              |||:::|
Human   328 GQPEDDQASTSTASEGEDNIDEDMEED 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 18/50 (36%)
MNTXP_011522170.1 HLH 230..280 CDD:278439 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.