DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and MXD1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_002348.1 Gene:MXD1 / 4084 HGNCID:6761 Length:221 Species:Homo sapiens


Alignment Length:145 Identity:34/145 - (23%)
Similarity:64/145 - (44%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQ 78
            :::|.|:......|:..|:::      |:.||.:|:.||.|::.....|:..||.  |.::||..
Human    37 NNKDRDALKRRNKSKKNNSSS------RSTHNEMEKNRRAHLRLCLEKLKGLVPL--GPESSRHT 93

  Fly    79 IL----------KKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGDQFSEFLSDE 133
            .|          ||..:|.:....:|.:.|::...:|||...:     .:|....|.....:|.|
Human    94 TLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKL-----GIERIRMDSIGSTVSSE 153

  Fly   134 EVGSEEADDEDLDQD 148
            .   .::|.|::|.|
Human   154 R---SDSDREEIDVD 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 17/60 (28%)
MXD1NP_002348.1 Nuclear localization signal. /evidence=ECO:0000255 21..49 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..68 8/36 (22%)
HLH 60..110 CDD:238036 15/51 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.