DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mycla

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_998102.1 Gene:mycla / 405873 ZFINID:ZDB-GENE-040426-2439 Length:372 Species:Danio rerio


Alignment Length:129 Identity:37/129 - (28%)
Similarity:65/129 - (50%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDDDRDIDIESD------EDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNL 62
            :|.:.|.:||..      |...:.:...||..|:.:..:..::|   |.|||:|||.::..|..|
Zfish   251 TDPEDDFEIEPVSKRPRLESSSAPSSPLSSPATSDSEDSTEQRR---NFLERKRRDDLRSRFQAL 312

  Fly    63 REAVPTLKG-EKASRAQILKKTTECI----QTMRRKISENQKDIEEIKRQNNIIAKQIQALESS 121
            ||.:|.|.| .|.|:..||.:.|:.:    .:.||:..|.:|    :|.:...:.::|.||::|
Zfish   313 REEIPGLSGSSKTSKVAILTQATDYLLQLHSSQRRQAQEKRK----LKAKQQQLLRRISALQNS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 20/55 (36%)
myclaNP_998102.1 Myc_N 17..269 CDD:279405 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..306 16/57 (28%)
HLH 292..346 CDD:238036 20/56 (36%)
Leucine-zipper 341..369 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.