DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mycb

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_956466.1 Gene:mycb / 393141 ZFINID:ZDB-GENE-040426-780 Length:396 Species:Danio rerio


Alignment Length:187 Identity:49/187 - (26%)
Similarity:76/187 - (40%) Gaps:70/187 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMSDDDRDIDIESDEDGD------------SDTGL------------------GSSRHTNTAN-- 34
            |.|||:.|.|.|.:|:.|            ||...                  ..:.|.:|.|  
Zfish   213 SESDDEDDEDEEEEEEIDVVTVEKRKSVKKSDANATHQSPVVLKRCHVNIHQHNYAAHPSTRNEQ 277

  Fly    35 --------------FTQA-----------------EKRAHHNALERRRRDHIKESFTNLREAVPT 68
                          |.|.                 :||..||.|||:||:.:|.||..||:.:|.
Zfish   278 PAVKRIKFESHIRVFKQISHNRKCASPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDVIPD 342

  Fly    69 L-KGEKASRAQILKKTTECIQTMRRKISENQKDI---EEIKRQNNIIAKQIQALESS 121
            : ..|||::..||||.||||.:|:   .:.|:.|   |:::|:...:.::::.|..|
Zfish   343 VANNEKAAKVVILKKATECIASMQ---EDEQRLISLKEQLRRKCEHLKQRLEQLSCS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 26/51 (51%)
mycbNP_956466.1 Myc_N 6..304 CDD:279405 16/90 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..251 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..318 2/19 (11%)
HLH 311..370 CDD:238036 27/61 (44%)
Myc-LZ 368..396 CDD:280500 5/27 (19%)
Leucine-zipper 372..393 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.