DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and max

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_005160676.1 Gene:max / 30467 ZFINID:ZDB-GENE-990415-152 Length:165 Species:Danio rerio


Alignment Length:175 Identity:72/175 - (41%)
Similarity:105/175 - (60%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MSDDDRDIDIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVP 67
            |||:| ||:::||||.....|:             |:||||||||||:||||||:||.:||::||
Zfish     1 MSDND-DIEVDSDEDSPRFHGV-------------ADKRAHHNALERKRRDHIKDSFHSLRDSVP 51

  Fly    68 TLKGEK-----ASRAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGD--- 124
            .|:|||     |||||||.|.||.||.||||...:|:||:::||||.::.:|::|||...|.   
Zfish    52 ALQGEKQSIKQASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKVKGTTQL 116

  Fly   125 QFSEFLSDEEV--------------GSEEADDEDLDQDFSRRNKK 155
            |.:...||..:              ||:.:.:.:.::..:|:..:
Zfish   117 QANYSSSDSSLYTNPKGSAVSAFDGGSDSSSESEPEEQRTRKKHR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 38/55 (69%)
maxXP_005160676.1 HLH 24..80 CDD:278439 38/55 (69%)
SlyX <86..>108 CDD:294687 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581960
Domainoid 1 1.000 75 1.000 Domainoid score I9053
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545748at2759
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 1 1.000 - - oto40887
orthoMCL 1 0.900 - - OOG6_104805
Panther 1 1.100 - - LDO PTHR10328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4638
SonicParanoid 1 1.000 - - X5516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.