DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mycl

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001398532.1 Gene:Mycl / 298506 RGDID:1588591 Length:399 Species:Rattus norvegicus


Alignment Length:78 Identity:30/78 - (38%)
Similarity:43/78 - (55%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KRAHHNALERRRRDHIKESFTNLREAVPTLKG-EKASRAQILKKTTECIQTMRRKISENQKDIEE 103
            ||.:||.|||:||:.::..|..||:.||||.. .||.:..||.|..|.:|.:   :...:|...|
  Rat   317 KRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQAL---VGAEKKMATE 378

  Fly   104 IKRQNNIIAKQIQ 116
             |||.....:|:|
  Rat   379 -KRQLRCRQQQLQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 27/68 (40%)
MyclNP_001398532.1 Myc_N 26..250 CDD:460045
bHLHzip_L-Myc 311..399 CDD:381463 30/78 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.