DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mxi1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_006231666.1 Gene:Mxi1 / 25701 RGDID:3128 Length:295 Species:Rattus norvegicus


Alignment Length:132 Identity:28/132 - (21%)
Similarity:65/132 - (49%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASR---AQILKKTTECI 87
            :.:|::.::.|....|:.||.||:.||.|::.....|:..:|.  |...:|   ..:|.|....|
  Rat   121 AQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPL--GPDCTRHTTLGLLNKAKAHI 183

  Fly    88 QTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGDQFSEFLSDEEVGS------EEADDEDLD 146
            :.:.....::|..:|.::|:...:.::::.|:   |.|..|.:..:.:||      .:::.|:::
  Rat   184 KKLEEAERKSQHQLENLEREQRFLKRRLEQLQ---GPQEMERIRMDSIGSTISSDRSDSEREEIE 245

  Fly   147 QD 148
            .|
  Rat   246 VD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 15/53 (28%)
Mxi1XP_006231666.1 HLH 140..192 CDD:197674 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.