DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and sre1

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_595694.1 Gene:sre1 / 2540730 PomBaseID:SPBC19C2.09 Length:900 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:27/105 - (25%)
Similarity:45/105 - (42%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSSRHTNTANFTQA----EKRAHHNALERRRRDHIKESFTNLREAVPTLK--------------- 70
            ||...:.|.:|...    .|:..||.:|:|.|.::.:....||:|||:|:               
pombe   242 GSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGNSLDDED 306

  Fly    71 ------GEKASRAQILKKTTECIQTMRRKISENQKDIEEI 104
                  ..|.::..||.|.||.|:.:..|..|.||..:::
pombe   307 LGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 23/86 (27%)
sre1NP_595694.1 bHLHzip_scHMS1_like 259..354 CDD:381405 23/88 (26%)
DUF2014 516..766 CDD:430604
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.