DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and sre1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_595694.1 Gene:sre1 / 2540730 PomBaseID:SPBC19C2.09 Length:900 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:27/105 - (25%)
Similarity:45/105 - (42%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSSRHTNTANFTQA----EKRAHHNALERRRRDHIKESFTNLREAVPTLK--------------- 70
            ||...:.|.:|...    .|:..||.:|:|.|.::.:....||:|||:|:               
pombe   242 GSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGNSLDDED 306

  Fly    71 ------GEKASRAQILKKTTECIQTMRRKISENQKDIEEI 104
                  ..|.::..||.|.||.|:.:..|..|.||..:::
pombe   307 LGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 19/71 (27%)
sre1NP_595694.1 HLH 261..333 CDD:278439 19/71 (27%)
DUF2014 517..766 CDD:286510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.