DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mycs

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_068609.2 Gene:Mycs / 24581 RGDID:3133 Length:430 Species:Rattus norvegicus


Alignment Length:91 Identity:36/91 - (39%)
Similarity:54/91 - (59%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTL-KGEKASRAQILKKTTECIQTM- 90
            |..:.::....|:|.:||.:||:|||.::.||.|||:.||.| ..|||::..||||.||.|.|: 
  Rat   336 RSRSNSDLEDIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQ 400

  Fly    91 ---------RRKISE-NQKDIEEIKR 106
                     |.|:.| .|:.:|:||:
  Rat   401 TDESKLLVEREKLYERKQQLLEKIKQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 34/79 (43%)
MycsNP_068609.2 Myc_N 10..331 CDD:460045
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..326
bHLHzip_N-Myc_like 344..430 CDD:381462 35/83 (42%)
Leucine-zipper 399..420 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.