DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Usf2

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_035810.1 Gene:Usf2 / 22282 MGIID:99961 Length:346 Species:Mus musculus


Alignment Length:90 Identity:28/90 - (31%)
Similarity:49/90 - (54%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KRAHHNALERRRRDHIKESFTNLREAVPTLKGEK----ASRAQILKKTTECIQTMR---RKISEN 97
            :||.||.:||||||.|......|.:.:|....:.    ||:..||.|..:.|:.:|   :::.|.
Mouse   236 RRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSKTGASKGGILSKACDYIRELRQTNQRMQET 300

  Fly    98 QKDIEEIKRQNNIIAKQIQALESSN 122
            .|:.|.::..|.::.:||:.|::.|
Mouse   301 FKEAERLQMDNELLRQQIEELKNEN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 19/54 (35%)
Usf2NP_035810.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..244 4/7 (57%)
bHLHzip_USF2 229..308 CDD:381493 23/71 (32%)
ZapB 290..>334 CDD:399182 9/36 (25%)
Leucine-zipper 307..328 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.