DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mxl-3

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_510223.1 Gene:mxl-3 / 181457 WormBaseID:WBGene00003511 Length:235 Species:Caenorhabditis elegans


Alignment Length:114 Identity:49/114 - (42%)
Similarity:68/114 - (59%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQ 78
            ||:|..|......|        ...::|||||.||||||||||:.||.|::|:|.|.|||:|||.
 Worm    30 SDDDSSSPKSASPS--------MDDDRRAHHNELERRRRDHIKDHFTILKDAIPLLDGEKSSRAL 86

  Fly    79 ILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGDQFS 127
            |||:..|.|..|:.|:|...|.||::.|:|.::.:::...|||.....|
 Worm    87 ILKRAVEFIHVMQTKLSSQGKAIEDLTRKNELLEERLLERESSGSPSSS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 32/50 (64%)
mxl-3NP_510223.1 bHLHzip_Max 48..116 CDD:381412 39/67 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159994
Domainoid 1 1.000 71 1.000 Domainoid score I6185
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545748at2759
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 1 1.000 - - oto17561
orthoMCL 1 0.900 - - OOG6_104805
Panther 1 1.100 - - LDO PTHR10328
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5516
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.