DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mycn

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_032735.3 Gene:Mycn / 18109 MGIID:97357 Length:462 Species:Mus musculus


Alignment Length:95 Identity:37/95 - (38%)
Similarity:61/95 - (64%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTL-KGEKASRAQILKKTTECIQT 89
            |.|::::.:   :|:|.:||.|||:||:.::.||..||:.||.| |.|||::..||||.||.:..
Mouse   369 SPRNSDSED---SERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHA 430

  Fly    90 MRRKISENQKDIEEIKRQNNIIAKQIQALE 119
            :  :.:|:|..:|:.|.|    |:|.|.|:
Mouse   431 L--QANEHQLLLEKEKLQ----ARQQQLLK 454

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 29/68 (43%)