DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mdl-1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_509136.1 Gene:mdl-1 / 180942 WormBaseID:WBGene00003163 Length:281 Species:Caenorhabditis elegans


Alignment Length:137 Identity:34/137 - (24%)
Similarity:58/137 - (42%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQILKKTTECIQTM 90
            ||:|:.||          ||.||:.||       .|||..:.|||......:...:.||..:.|.
 Worm    92 SSKHSRTA----------HNELEKTRR-------ANLRGCLETLKMLVPCVSDATRNTTLALLTR 139

  Fly    91 RRK--ISENQKDIEEIKRQNNIIAKQIQALESSNGDQFSEFLSDEEVGSEEADD-EDLDQDFSRR 152
            .|.  |.....:..::|:.|::..:|.:.:.     :.::..:||||....:.. :.|.|  ||.
 Worm   140 ARDHIIELQDSNAAQMKKLNDLRDEQDELVA-----ELAQLQADEEVAQATSQACQTLSQ--SRP 197

  Fly   153 NKKMKTF 159
            ..:..:|
 Worm   198 ESRASSF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 15/50 (30%)
mdl-1NP_509136.1 bHLHzip_Mad 97..172 CDD:381407 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.