DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mxl-1

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_505856.1 Gene:mxl-1 / 179557 WormBaseID:WBGene00003509 Length:124 Species:Caenorhabditis elegans


Alignment Length:128 Identity:47/128 - (36%)
Similarity:69/128 - (53%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MSDDDRDIDIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVP 67
            |||..   |:|.|:.|.    .||..|:...: .:...|..||||||||||:||:.:|:|||.||
 Worm     1 MSDMS---DLEDDQTGH----CGSGEHSGPFD-PKRHAREQHNALERRRRDNIKDMYTSLREVVP 57

  Fly    68 TLKGEK--ASRAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNGDQFSE 128
            ...||:  ||||.||||..|.|:..:...:....|:.|.:.:|..:.::|..|::......|:
 Worm    58 DANGERVQASRAVILKKAIESIEKGQSDSATLSVDVAEQESKNAKLREEIARLKAKKDPSSSQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 31/52 (60%)
mxl-1NP_505856.1 bHLH_SF 31..100 CDD:412148 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3922
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4638
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.