DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mycs

DIOPT Version :10

Sequence 1:NP_649097.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_034980.2 Gene:Mycs / 17870 MGIID:1332242 Length:431 Species:Mus musculus


Alignment Length:95 Identity:38/95 - (40%)
Similarity:58/95 - (61%) Gaps:15/95 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTL-KGEKASRAQILKKTTECI 87
            |||   .|.:::...|:|.:||.:||:|||.::.||.|||:.||.| ..|||::..||||.||.|
Mouse   336 LGS---RNNSDWENIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYI 397

  Fly    88 QTM----------RRKISENQKD-IEEIKR 106
            .|:          |:|:.|.|:. :::||:
Mouse   398 HTLQADESKLLVERKKLYERQQQLLQKIKQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_649097.1 bHLHzip_Max 40..108 CDD:381412 33/79 (42%)
MycsNP_034980.2 Myc_N 10..332 CDD:460045
bHLHzip_N-Myc_like 345..431 CDD:381462 34/83 (41%)
Leucine-zipper 400..421 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.