DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Myc

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_034979.3 Gene:Myc / 17869 MGIID:97250 Length:454 Species:Mus musculus


Alignment Length:100 Identity:34/100 - (34%)
Similarity:59/100 - (59%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLK-GEKASRAQILKKTTE---C 86
            |.|.::|   .:.:||..||.|||:||:.:|.||..||:.:|.|: .|||.:..||||.|.   .
Mouse   359 SPRSSDT---EENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS 420

  Fly    87 IQTMRRKISENQKDIEEIKRQNNIIAKQIQALESS 121
            ||....|:: ::||:  ::::...:..:::.|.:|
Mouse   421 IQADEHKLT-SEKDL--LRKRREQLKHKLEQLRNS 452

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 26/54 (48%)