DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and mxl-2

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_497173.1 Gene:mxl-2 / 175184 WormBaseID:WBGene00003510 Length:205 Species:Caenorhabditis elegans


Alignment Length:129 Identity:34/129 - (26%)
Similarity:64/129 - (49%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMSDDDRDIDIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAV 66
            |.|....|:|:.|.:...|.....::..||:..|:...|:|.|...||:||:.|...:::|::.:
 Worm    10 SSSQKPDDMDLMSPDGSASSPSAPNTPATNSGGFSSDRKKATHLRCERQRREAINSGYSDLKDLI 74

  Fly    67 P---TLKGEKASRAQILKKTTECIQTMRRKISENQKDIEEIKRQN---NIIAKQIQALESSNGD 124
            |   |..|.|.:.|.||.:..:.:..::..||:..|.:.::..|.   .:||.:.:.:.||..|
 Worm    75 PQTTTSLGCKTTNAAILFRACDFMSQLKTDISDADKQLAQLNAQAAALEMIASEYEQMASSVPD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 16/53 (30%)
mxl-2NP_497173.1 bHLHzip_Mlx_like 47..110 CDD:381410 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.