DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mnt

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_034943.3 Gene:Mnt / 17428 MGIID:109150 Length:591 Species:Mus musculus


Alignment Length:138 Identity:38/138 - (27%)
Similarity:64/138 - (46%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKAS 75
            :.:|.|......|:|:              |..||.||:.||.|:||.|..|:..:|.:..:|.|
Mouse   208 EAKSSEQKKRPGGIGT--------------REVHNKLEKNRRAHLKECFETLKRNIPNVDDKKTS 258

  Fly    76 RAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALESSNG-DQFSEFLSDEEVGSEE 139
            ...:|:.....||:::||..|.:.::|.:.|:.  ||.|.:..|..:. .|:.:.|..:.|..:.
Mouse   259 NLSVLRTALRYIQSLKRKEKEYEHEMERLAREK--IATQQRLAELKHELSQWMDVLEIDRVLRQT 321

  Fly   140 ADDEDLDQ 147
            ...|| ||
Mouse   322 GQPED-DQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 18/50 (36%)
MntNP_034943.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..122
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..223 3/14 (21%)
HLH 224..274 CDD:278439 18/49 (37%)
Leucine-zipper 273..301 8/29 (28%)
DUF2630 281..339 CDD:287859 13/51 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..426 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.