DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Max

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_032584.2 Gene:Max / 17187 MGIID:96921 Length:160 Species:Mus musculus


Alignment Length:177 Identity:73/177 - (41%)
Similarity:108/177 - (61%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MSDDDRDIDIESDEDGDSDTGLGSSRHTNTANF-TQAEKRAHHNALERRRRDHIKESFTNLREAV 66
            |||:| ||::||||:              ...| :.|:||||||||||:||||||:||.:||::|
Mouse     1 MSDND-DIEVESDEE--------------QPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSV 50

  Fly    67 PTLKGEKASRAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALE------------ 119
            |:|:||||||||||.|.||.||.||||...:|:||:::||||.::.:|::|||            
Mouse    51 PSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNY 115

  Fly   120 ---------SSNGDQFSEFLSDEEVGSEEADDEDLDQDFSRRNKKMK 157
                     ::.|...|.|    :.||:.:.:.:.::..||:..:|:
Mouse   116 PSSDNSLYTNAKGGTISAF----DGGSDSSSESEPEEPQSRKKLRME 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 38/50 (76%)
MaxNP_032584.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 13/39 (33%)
bHLHzip_Max 24..92 CDD:381412 43/68 (63%)
Leucine-zipper 81..102 11/20 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..160 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838137
Domainoid 1 1.000 81 1.000 Domainoid score I8516
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4765
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 1 1.000 - - oto91978
orthoMCL 1 0.900 - - OOG6_104805
Panther 1 1.100 - - LDO PTHR10328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4638
SonicParanoid 1 1.000 - - X5516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.