DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Max and Mxd4

DIOPT Version :9

Sequence 1:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_034883.2 Gene:Mxd4 / 17122 MGIID:104991 Length:209 Species:Mus musculus


Alignment Length:163 Identity:39/163 - (23%)
Similarity:68/163 - (41%) Gaps:40/163 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DGDSDTGLGSSRHTNTANFTQ--AEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASR--- 76
            |||.     :.:.|.||...:  ...|:.||.||:.||..::.....|::.||.  |..::|   
Mouse    34 DGDF-----ARKKTKTAGLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPL--GPDSTRHTT 91

  Fly    77 AQILKKTTECIQTM----RRKISENQKDIEEIKRQNNIIAKQIQALE---------SSNGDQFSE 128
            ..:||:....|:.:    ||.:|..    |:::|::..:.::::.|.         .|.|...|.
Mouse    92 LSLLKRAKMHIKKLEEQDRRALSIK----EQLQREHRFLKRRLEQLSVQSVERVRTDSTGSAVST 152

  Fly   129 FLSDEEV-------GSEEAD----DEDLDQDFS 150
            ..|::||       |..|.|    ..|.|..:|
Mouse   153 DDSEQEVDIEGMEFGPGELDSAGSSSDADDHYS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MaxNP_001246833.1 HLH 40..91 CDD:278439 15/57 (26%)
Mxd4NP_034883.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:8521822 6..23
bHLHzip_Mad4 53..140 CDD:381499 21/92 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..209 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.