DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and AT1G29060

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_564319.1 Gene:AT1G29060 / 839780 AraportID:AT1G29060 Length:134 Species:Arabidopsis thaliana


Alignment Length:120 Identity:29/120 - (24%)
Similarity:51/120 - (42%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SHDALEAENEQAAEELKQKIG------------------ALKSLTIDIGNEVRYQDKLLRGIDDD 68
            |.:.|...|...:||::.:|.                  .||::..:||:|.:.|...|    |:
plant    20 SREGLSTRNASGSEEIQLRIDPMHSDLDDEILGLHGQVRQLKNIAQEIGSEAKSQRDFL----DE 80

  Fly    69 MDRT-----SGFLGNAMTRVVRLAKQGGGARQMCYMFLFILVVFLILWITLK-FK 117
            :..|     :|...|  .|.:.|:....|...:.::.||.|::|.||::..| ||
plant    81 LQMTLIRAQAGVKNN--IRKLNLSIIRSGNNHIMHVVLFALLLFFILYMWSKMFK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 13/69 (19%)
SNARE 65..111 CDD:283412 12/50 (24%)
AT1G29060NP_564319.1 SNARE_Qc 45..100 CDD:277194 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.