DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and BS14A

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_191376.1 Gene:BS14A / 824986 AraportID:AT3G58170 Length:122 Species:Arabidopsis thaliana


Alignment Length:92 Identity:29/92 - (31%)
Similarity:50/92 - (54%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVRL 86
            ||:..|.|||:|.|.|:.::..||.|:.||..||...:::|..:.:|||.:.|||...|.|...:
plant    30 SHEINEHENERALEGLQDRVILLKRLSGDINEEVDTHNRMLDRMGNDMDSSRGFLSGTMDRFKTV 94

  Fly    87 AKQGGGARQMCYMFLFILVVFLILWIT 113
            .:.....|.:..:..|:.:..:|.::|
plant    95 FETKSSRRMLTLVASFVGLFLVIYYLT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 16/46 (35%)
SNARE 65..111 CDD:283412 11/45 (24%)
BS14ANP_191376.1 SNARE_Bet1 35..93 CDD:277206 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101026
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.