DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and bet1

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001016442.1 Gene:bet1 / 549196 XenbaseID:XB-GENE-977126 Length:113 Species:Xenopus tropicalis


Alignment Length:109 Identity:46/109 - (42%)
Similarity:65/109 - (59%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LNQHPSGPHP--ASHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTS 73
            :.....||..  :.:...|.|||:..|.||.|..|||||||||||||:|.:|:|..:|.|.|.|.
 Frog     6 MKHREGGPRTEMSGYSVYEEENERMTENLKMKASALKSLTIDIGNEVKYHNKMLGEMDSDFDSTG 70

  Fly    74 GFLGNAMTRVVRLAKQGGGARQMCYMFLFILVVFLILWITLKFK 117
            |.||..|.| :::..:|..|:.:|||.||.|.||.:::..:|.:
 Frog    71 GLLGATMGR-LKILSRGSQAKLLCYMMLFALFVFFVIYWFIKLR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 27/46 (59%)
SNARE 65..111 CDD:283412 19/45 (42%)
bet1NP_001016442.1 SNARE_Bet1 24..82 CDD:277206 33/58 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38108
Inparanoid 1 1.050 89 1.000 Inparanoid score I4974
OMA 1 1.010 - - QHG52359
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 1 1.000 - - oto103876
Panther 1 1.100 - - LDO PTHR12791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R135
SonicParanoid 1 1.000 - - X6161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.