DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and Bet1l

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_061212.3 Gene:Bet1l / 54399 MGIID:1913128 Length:111 Species:Mus musculus


Alignment Length:91 Identity:31/91 - (34%)
Similarity:51/91 - (56%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVR 85
            |..|.|:.||::.|:.|..|:..||||.:||..:...|::.|.|:|.|....:|.|..::.|...
Mouse    12 AVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFST 76

  Fly    86 LAKQGGGARQ-MCYMFLFILVVFLIL 110
            :|:.|...|: :|.|.:.::|.|.||
Mouse    77 MARSGRDNRKLLCGMAVVLIVAFFIL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 15/46 (33%)
SNARE 65..111 CDD:283412 14/47 (30%)
Bet1lNP_061212.3 SNARE_Bet1 18..76 CDD:277206 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.