DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and Bet1

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_062124.1 Gene:Bet1 / 29631 RGDID:2203 Length:118 Species:Rattus norvegicus


Alignment Length:113 Identity:42/113 - (37%)
Similarity:68/113 - (60%) Gaps:11/113 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDM 69
            ||.|.          .:.::|.|.||::..|.|:.|:.|:|||:|:||:||:.|:|||..:|...
  Rat    17 NYGYA----------NSGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQF 71

  Fly    70 DRTSGFLGNAMTRVVRLAKQGGGARQMCYMFLFILVVFLILWITLKFK 117
            |.|:||||..|.| :::..:|...:.:|||.||.|.||.:::..:|.:
  Rat    72 DSTTGFLGKTMGR-LKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 23/46 (50%)
SNARE 65..111 CDD:283412 18/45 (40%)
Bet1NP_062124.1 SNARE_Bet1 29..87 CDD:277206 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38108
Inparanoid 1 1.050 82 1.000 Inparanoid score I5098
OMA 1 1.010 - - QHG52359
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 1 1.000 - - oto97186
orthoMCL 1 0.900 - - OOG6_101026
Panther 1 1.100 - - LDO PTHR12791
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6161
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.