DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and nbet-1

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001023538.1 Gene:nbet-1 / 259570 WormBaseID:WBGene00043064 Length:107 Species:Caenorhabditis elegans


Alignment Length:97 Identity:38/97 - (39%)
Similarity:57/97 - (58%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GPHPASHDA--LEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTSGFLGNA 79
            ||   :.||  ||..|:.....|..|:.|||.:||.||::||.|::||..:|:|.|.:.|.|.:.
 Worm    10 GP---NQDANYLERHNDDLVGGLSSKVAALKRVTIAIGDDVREQNRLLNDMDNDFDSSKGLLQST 71

  Fly    80 MTRVVRLAKQGGGARQMCYMFLFILVVFLILW 111
            |.| :.|..:.||...:||:.||.|.||.:::
 Worm    72 MRR-LGLVSRAGGKNMLCYLILFALFVFFVVY 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 20/46 (43%)
SNARE 65..111 CDD:283412 17/45 (38%)
nbet-1NP_001023538.1 SNARE_Bet1 19..76 CDD:277206 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3923
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52359
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 1 1.000 - - oto18496
orthoMCL 1 0.900 - - OOG6_101026
Panther 1 1.100 - - LDO PTHR12791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R135
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.