DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and sft1

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_592925.1 Gene:sft1 / 2542585 PomBaseID:SPAC31A2.13c Length:91 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:26/95 - (27%)
Similarity:46/95 - (48%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLR------GIDDDMDR-TSGFLGNAMTRVVRL 86
            :||:..|.|..::.:||::|.||.:......::.|      |:.:.:.: |..|.     ||||.
pombe     4 QNERRLETLSGQVSSLKNVTYDIYSRANDYTRIDRATESFSGLSNSVKKSTENFF-----RVVRS 63

  Fly    87 AKQGGGARQMCYMFLFILVVFLILWITLKF 116
            |    |.|::..|.|.|:...||::...|:
pombe    64 A----GRRRIMTMVLAIVGSILIIYYASKW 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 11/53 (21%)
SNARE 65..111 CDD:283412 14/46 (30%)
sft1NP_592925.1 SNARE_Bet1 3..59 CDD:277206 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101026
Panther 1 1.100 - - O PTHR12791
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.