DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and bet1

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_593185.1 Gene:bet1 / 2542068 PomBaseID:SPAC23C4.13 Length:117 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:35/109 - (32%)
Similarity:57/109 - (52%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RRNNYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGID 66
            :..|....||.:..|   |...|:||.||::...:|..|:.:||.||::||.|:....||:..::
pombe     9 KERNGDMLPLYESQS---PQHLDSLENENDERISKLTGKVKSLKELTMNIGTEITSSTKLMESMN 70

  Fly    67 DDMDRTSGFLGNAMTRVVRLAKQGGGARQMCYMFLFILVVFLIL 110
            |..|.|...|...|||:..::|.||.:..|...|..::.:.|:|
pombe    71 DSFDSTKSLLSGTMTRLKNVSKNGGISIWMWLAFFCLVALILVL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 17/46 (37%)
SNARE 65..111 CDD:283412 14/46 (30%)
bet1NP_593185.1 SNARE_Bet1 31..89 CDD:277206 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I1988
OMA 1 1.010 - - QHG52359
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 1 1.000 - - oto101292
orthoMCL 1 0.900 - - OOG6_101026
Panther 1 1.100 - - LDO PTHR12791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R135
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.