DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet1 and bet1l

DIOPT Version :9

Sequence 1:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_002937686.1 Gene:bet1l / 100379730 XenbaseID:XB-GENE-973698 Length:111 Species:Xenopus tropicalis


Alignment Length:100 Identity:34/100 - (34%)
Similarity:55/100 - (55%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GPHPASHD-ALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTSGFLGNAM 80
            ||:..:.| .|:|||::.:|.|..|:..||||.:||..|....:|.|.|:|.|....:|.|..::
 Frog     7 GPNSGAVDEMLDAENKRLSENLSSKVTRLKSLALDIDKEADDHNKYLDGMDSDFLSVTGLLSGSV 71

  Fly    81 TRVVRLAKQGGGARQ-MCYMF-----LFILVVFLI 109
            .|...:|:.|...|: :||:.     ||.|:.:|:
 Frog    72 KRFTGMARSGRDNRKLLCYVSSGLVGLFFLLYYLV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 16/46 (35%)
SNARE 65..111 CDD:283412 14/50 (28%)
bet1lXP_002937686.1 SNARE_Bet1 18..75 CDD:277206 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.